Sermorelin, tesamorelin and CJC-1295 are all built on human growth hormone-releasing hormone and are described in the literature as ligands of the GHRH receptor. Ipamorelin is a different thing: a five-residue synthetic peptide from a Novo Nordisk chemistry programme that the literature describes as acting at the growth hormone secretagogue receptor, the receptor whose natural ligand is ghrelin. Tesamorelin is the active ingredient of an FDA-approved product, sermorelin was the active ingredient of one that has been discontinued, and ipamorelin and CJC-1295 have never been approved in the United States.

Two receptor classes

The first class is the GHRH receptor. Human GHRH (somatoliberin) is a 44-residue amidated peptide; its receptor is a G protein-coupled receptor cloned in 1992 and expressed predominantly, if not exclusively, in the anterior pituitary, homologous to the secretin and VIP receptors. Sermorelin, tesamorelin and CJC-1295 are all variations on the GHRH sequence and are described as binding that receptor.

The second class is the growth hormone secretagogue receptor (GHS-R). It was cloned in the 1990s as the target of small synthetic "secretagogue" molecules, and its endogenous ligand, ghrelin, a 28-residue acylated peptide from the stomach, was identified in 1999. Ipamorelin belongs to this class. It is not a GHRH analogue and shares no sequence with GHRH.

WADA's 2026 list keeps the two classes apart for the same reason: section S2.2.4 lists "GHRH and its analogues (e.g. CJC-1293, CJC-1295, sermorelin and tesamorelin)" in one clause and "growth hormone secretagogues (GHS) and their mimetics [e.g. ... ipamorelin ...]" in another. Both clauses are prohibited at all times.

Sermorelin: GRF(1-29) amide

Sermorelin is the first 29 residues of human GHRH with a C-terminal amide, YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2. No substitutions, no lipid, no cap. PubChem CID 16132413 gives C149H246N44O42S and an average molecular weight of 3357.9; CAS 86168-78-7. The single methionine at position 27 is the residue most exposed to oxidation in this sequence.

Drugs@FDA lists Geref (sermorelin acetate), NDA 020443, EMD Serono, approved September 26, 1997, with marketing status "Discontinued" and a note that a Federal Register determination found the product "was not discontinued or withdrawn for safety or effectiveness reasons." Because sermorelin acetate is a component of an approved drug, it appears in FDA's 503B Category 1 list with the approved-component mark and is not on the 503A category lists. The catalog carries sermorelin, the 29-residue amide, as a lyophilized vial.

Tesamorelin: GRF(1-44) with a hexenoyl cap

Tesamorelin is the full 44-residue GHRH sequence with one modification: a trans-3-hexenoyl group on the N-terminal tyrosine. The Egrifta SV label describes it as "comprised of the 44 amino acid sequence of human GRF and a hexenoyl moiety, a C6 chain with a double bond at position 3, attached to the tyrosine residue at the N-terminal part of the molecule," prepared as an acetate salt. The 2007 non-clinical paper on the molecule (then coded TH9507) reports that this small cap made the peptide resistant to dipeptidyl aminopeptidase-IV cleavage in rat, dog and human plasma.

PubChem CID 16137828 gives C221H366N72O67S and 5136 (the label says 5135.9); CAS 218949-48-5. Drugs@FDA lists Egrifta (tesamorelin acetate), application 022505, Theratechnologies, approved November 10, 2010, marketing status Prescription; the former NDA was deemed a BLA on March 23, 2020. Two presentations, Egrifta SV and Egrifta WR, carry labels on DailyMed.

The approved product and a research vial labelled "tesamorelin" are not the same article. FDA's 2026 warning letters to research-peptide sellers name "Tesamorelin" and "Tesa Peptide" as unapproved new drugs; "Egrifta" is the name of the approved product, not of research material. The catalog's tesamorelin is research material of that 44-residue sequence.

Ipamorelin: a pentapeptide with three unusual residues

Ipamorelin is Aib-His-D-2-Nal-D-Phe-Lys-NH2, five residues, three of which are not among the twenty coded amino acids in their usual form: Aib (2-aminoisobutyric acid, an alpha,alpha-disubstituted residue), D-2-naphthylalanine and D-phenylalanine. PubChem CID 9831659 gives C38H49N9O5 and 711.9; CAS 170851-70-4; Novo Nordisk code NNC 26-0161.

The 1998 paper that introduced it says it was "identified within a series of compounds lacking the central dipeptide Ala-Trp of growth hormone-releasing peptide (GHRP)-1", and that it acts "via a GHRP-like receptor", the receptor now called GHS-R. It was studied in primary rat pituitary cells, anaesthetised rats and conscious swine. Helsinn later ran two Phase 2 trials (NCT00672074 and NCT01280344, both completed) with no approval following.

FDA placed ipamorelin acetate in 503B Category 2 on September 29, 2023 and it is still there as of September 21, 2026; its 503A nomination was withdrawn. FDA's Category 2 entry cites a published clinical report of serious adverse events, including death, in a study of ipamorelin (bulk drug substances page, content current April 22, 2026).

We stock ipamorelin as a lyophilized vial.

CJC-1295: substituted GRF(1-29) with an albumin-binding handle

CJC-1295 is GRF(1-29) with four substitutions and a thirtieth residue, a lysine carrying a maleimide that bonds to serum albumin; the full identity, and the difference from the DAC-less "Mod GRF 1-29", is in CJC-1295 with DAC and without. Its only registered trial, a ConjuChem Phase 2 (NCT00267527), is terminated, and it was already outside 503A Category 2 by September 27, 2024; the April 22, 2026 page lists it as withdrawn. We stock CJC-1295 as a lyophilized vial.

The comparison table

Status lines are as of September 21, 2026.

Three statuses, one shelf

The three statuses in the title are an approved product still marketed (tesamorelin), an approved product discontinued for reasons other than safety or effectiveness (sermorelin), and no approval at all (ipamorelin, CJC-1295). Regulatory status attaches to a product and a sponsor, not to a molecule in a research vial; a vial of tesamorelin is not Egrifta any more than a vial of sermorelin is Geref. All four sit on the hormones shelf as research-use-only lyophilized vials.

Sources

• Sermorelin, CID 16132413, PubChem
• Tesamorelin, CID 16137828, PubChem
• Ipamorelin, CID 9831659, PubChem
• CJC 1295, CID 91971820, PubChem
• Drugs@FDA: Geref, NDA 020443, FDA
• Drugs@FDA: Egrifta, BLA 022505, FDA
• Egrifta SV (tesamorelin) prescribing information, DailyMed, National Library of Medicine
• Raun K et al. Ipamorelin, the first selective growth hormone secretagogue. Eur J Endocrinol, 1998
• Ferdinandi ES et al. Non-clinical pharmacology and safety evaluation of TH9507. Basic Clin Pharmacol Toxicol, 2007
• Kojima M et al. Ghrelin is a growth-hormone-releasing acylated peptide from stomach. Nature, 1999
• FDA, Certain bulk drug substances for use in compounding that may present significant safety risks, content current April 22, 2026
• WADA, The 2026 Prohibited List, valid 1 January 2026